DPCstruct | MC8828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 129 ± 14 aa |
| Standard deviation of domain lengths | 14.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8CA41 | 20-151 | LDDQEIAFKMIKSNISTVVGQLDDLRKNPKKFICLNDNIEHNKPDAQTVKAILQDYYESVLPIQSQFELPREYRNRFLHVDELRQWK… |
| A0A402EFJ2 | 25-153 | KNKYRFEIMGEEEVAFKMIRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHSHKDAQTVKAVLRDFYESLFPVPSQFELPREYRNRFLH… |
| A0A267G7A9 | 475-573 | None |
| A0A7S0RJ67 | 243-375 | None |
| A0A811VI77 | 331-476 | None |
| A0A6J0WK18 | 863-1021 | None |
| A0A830HE70 | 1-151 | None |
| A0A7S3PCL5 | 88-210 | None |
| A0A653C7T1 | 203-347 | None |
| Q32PR2 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.