DPCstruct | MC8824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 144 |
|---|---|
| Mean domain length (aa) | 233 ± 45 aa |
| Standard deviation of domain lengths | 45.02 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0511- CL0219- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8C3N6 | 10-246 | NVQAPFAQVEIPAPVPMPNQNGEINNDPMLIPNQSECDVYVSQNLKENIWNREFIDLSLLLYQNFISQIDRPQNIIISYDNAACSLV… |
| A0A0D0BY12 | 25-253 | SEFRWAAESFIKNSVLSEKHKAVIRKVDNYSADLNVAIKSIKKSSCNPSFPRKLWRAVLKDQYIELNEVNALVSTLQITGERAWRWA… |
| A0A2H3C2S1 | 210-423 | None |
| A0A0C9T1N8 | 204-385 | None |
| A0A4S8MEF4 | 62-307 | None |
| M1VUZ7 | 46-269 | None |
| M1VXI6 | 2-194 | None |
| M1W236 | 12-256 | None |
| A0A7M7HPM6 | 2-231 | None |
| A0A535SK40 | 111-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.