DPCstruct | MC8822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 197 ± 15 aa |
| Standard deviation of domain lengths | 15.37 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3UZ60 | 2-188 | VVFIKGSTQVGQNMFALGGIDHAFAESVLGRACNGKASTSECAIPITHKNNKNGYTKPWKQGDHFLDWYGAEDSQCNGCSNIPFGTP… |
| A0A6J8BRY7 | 210-394 | VILWNTVSGQHLFIRGGIDDRHRSGCKDIPLASMNNCSIPIKSRDLGSGGLAAAYNAWRKRDTFLDLYEPQPGQGTFQGKGAHGTPA… |
| A0A7R8X0W4 | 667-862 | None |
| A0A0B1TSN5 | 9-205 | None |
| A0A7R9FQZ3 | 195-399 | None |
| A0A6P4Y3Y9 | 868-1078 | None |
| V3ZGT8 | 55-270 | None |
| A0A5N5SL08 | 4-156 | None |
| A0A0B1T8D8 | 210-408 | None |
| A0A3S1BRD5 | 222-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.