DPCstruct | MC8820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 149 ± 8 aa |
| Standard deviation of domain lengths | 7.58 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A210PL96 | 3-147 | IGALLWILFLVRYSECTCTLPTNLVGSWTSSEQGSMTFTSTSLLSYPTTTFGTFTFTCDSYSGSQYVLKSPSFTYLTLPFEAYLCLV… |
| A0A6J8BNZ1 | 1-159 | MIHTKYIAIFALVAVLFDYTDGKCHFPDELKGSWKEPSGDDTLLQFTSDELTGFKLNVPRLSQSDFECINSRVDGDATKYMLRARDS… |
| A0A8B6EKX4 | 1-153 | None |
| A0A8B6C5B8 | 8-160 | None |
| A0A2T7PZL8 | 9-142 | None |
| A0A210PNJ5 | 11-156 | None |
| A0A8B6DG39 | 260-418 | None |
| K1RSN8 | 160-297 | None |
| A0A8B6DVJ1 | 4-158 | None |
| A0A8B6GJ12 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.