DPCstruct | MC882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 202 ± 17 aa |
| Standard deviation of domain lengths | 17.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 16.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5XTI0 | 41-233 | GERFETGLTVYDEYFSTVHQLHGEVVNAERQETDAISTLASVLDLLPTAPAAQVLRKLRERLPTLPAMELVTHDPIQGKPPSATVRL… |
| A0A819M832 | 220-403 | FRPVSYKQVDDLFKSVVEPLETAFEYRHAVEHSLCELNERCGLPDISNVKQCVRKIASRLQNANLVGAVIIRNKSLLPMFEYSPTLP… |
| A0A7R9KY47 | 246-448 | None |
| A0A2B4SP84 | 462-687 | None |
| R7U237 | 61-259 | None |
| A0A3S1BKJ4 | 24-256 | None |
| A0A553P5C3 | 20-226 | None |
| A0A0N5CPM6 | 3-214 | None |
| A0A817I8U1 | 649-833 | None |
| A0A6P9BCK6 | 15-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.