DPCstruct | MC8819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 109 ± 15 aa |
| Standard deviation of domain lengths | 14.86 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8BM43 | 5-136 | ECMYVKQVEQIKGTSIGKAIVKLTGIEGAERDERQEKLRKILQSLITYINQHPIQRIWENSEVTVYDCEYNIVKICSGSKINKFIVN… |
| A0A6P9C4U7 | 326-410 | PLSLASILNVDQQLASLEGSEELRQCLNEIIEEFPKEPHTVQDNAVLEVSCGGSNVTFRSGDGKNEINVYKDTQGKIVFNVKGRG |
| A0A7D9EA66 | 5-96 | None |
| A0A402FGV0 | 200-293 | None |
| A0A402FNB3 | 151-267 | None |
| A0A6J8D8R5 | 79-199 | None |
| A0A6J8DBG8 | 98-220 | None |
| A0A6J8DBH9 | 7-126 | None |
| A0A6P3VQF9 | 640-730 | None |
| A0A6P4XMS9 | 26-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.