DPCstruct | MC8818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 350 ± 50 aa |
| Standard deviation of domain lengths | 50.31 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8BL20 | 33-383 | LKCEIEVYQKRLDAKYKAIAILREQSKKLQDFREVQKKKSYIYNHSLEQEVNKLHFELDQKEVSLENSQAIWAERFDNVCRENSSLT… |
| A0A224Y861 | 47-316 | DEVSSLQSELDICRRLLNAKYLAAHILLKQLVRVSEEKEEGTRQSHRQCAQLLKELNGLQYELQCMEEHLRRSQQAWLDRLNSLVQE… |
| A0A7I8VTP8 | 109-419 | None |
| H3C647 | 2-299 | None |
| A0A6P8SVZ1 | 1-440 | None |
| A0A553NKG4 | 69-409 | None |
| R7ULK9 | 181-567 | None |
| B2RYD1 | 2-292 | None |
| H2RXI5 | 1-456 | None |
| A0A812APQ6 | 159-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.