DPCstruct | MC8816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 322 ± 34 aa |
| Standard deviation of domain lengths | 34.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W5YQ60 | 286-599 | EICCGCDEKPGPQVHLVDPEPQKQYTFESNNPGTLEVKFKAEVTPATPDSLQKMQDKVLFKMGTIGNAKMEWDPANPGGKPAIEGDF… |
| A0A838P6A7 | 46-377 | SPERIEYELFLDCTAEIEQPIENDELVFNDEQPGKIEEYAQADVTPGIWGPSVRWSFPQINDAKVEPTPEDAAGDSLRYSYAGLPEK… |
| A0A2V5ZK69 | 1-259 | None |
| A0A7V8AT79 | 7-293 | None |
| A0A7C3J2K1 | 413-775 | None |
| A0A235F3K1 | 282-603 | None |
| A0A7C6UGX1 | 67-388 | None |
| A0A7C6UF65 | 175-497 | None |
| A0A426VXK3 | 142-457 | None |
| A0A7V9JGN4 | 412-676 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.