DPCstruct | MC8814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 292 ± 37 aa |
| Standard deviation of domain lengths | 36.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9REC4 | 28-305 | RNSVAHPRTPYRLSFYNRHRRSYRVASALHFAHSKLHDVLLLTAFENHAAEDKKLYKQVINFYKKPPRIEPTMELYAPYTARATWQL… |
| A0A838P0T3 | 2-324 | TLLAVGTASLAGPAPAAAQDNRDEQFYYPGSFNWRFLELYPEAARLFNAFDYGHSILYEKLLTKGQAAEPALAREYRYLTRDLLVRP… |
| A0A1W9I336 | 27-309 | None |
| A0A1W9IY33 | 17-290 | None |
| A0A2K9NSD6 | 2-250 | None |
| A0A7Y4VYL3 | 21-338 | None |
| A0A843T0W3 | 40-332 | None |
| A0A7V9AJD7 | 3-313 | None |
| K9XNS2 | 55-358 | None |
| W0RQ84 | 5-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.