DPCstruct | MC8813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 364 ± 39 aa |
| Standard deviation of domain lengths | 38.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 13.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M1SHQ0 | 7-334 | IRLTSSEIASLWSAYMNNSMSYCMLMYFKEKTQDTEIQSILEFAIEVSKTLLQNITDIYDKENHAIPVAFSVNEDVNLNAPALYSDT… |
| A0A838NLQ1 | 39-399 | PTVRRDPGYGTSAAADTAYIRQTIRGNFFEVGLGRVADSRAQDSGVKQFAERMISEHNSMNQQWAALAKTNRMATNVFDVGPSEQQT… |
| A0A814B0S5 | 190-589 | None |
| A0A1G7NL66 | 173-575 | None |
| A0A559K743 | 74-370 | None |
| A0A254TFQ7 | 6-327 | None |
| A0A7T8RTI8 | 5-342 | None |
| A0A838QNT0 | 7-388 | None |
| A0A840PCH1 | 2-422 | None |
| A0A1V5IKY9 | 52-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.