DPCstruct | MC8812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 174 ± 16 aa |
| Standard deviation of domain lengths | 15.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 15.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523QQC4 | 5-151 | NIEDVIKKHSFKWPGGDIENYDHVVVYNAISNSGSHKVSVGYTYRNTYGRNRRRVVVWIDDYPYAEFLEADDFDVSGEVLSEIRFYD… |
| A0A838NK03 | 12-192 | VAVEPGEVRRAKWTFAKGGRQAPVKGSEHLYSVTDGNLASRNKWEFLVRVPDAADGRVEIRPRTTPPIHTWKALTYRSLQFQKATKG… |
| A0A497FZH6 | 56-211 | None |
| A0A352XPG5 | 205-384 | None |
| A0A2D6R0Z4 | 444-618 | None |
| A0A2E0SRN3 | 2-179 | None |
| A0A7V0QR36 | 1-175 | None |
| A0A1N7EQI6 | 55-217 | None |
| A0A0M4DZD0 | 5-203 | None |
| A0A256Z3E6 | 8-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.