DPCstruct | MC8809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 139 ± 20 aa |
| Standard deviation of domain lengths | 20.29 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J9EMY3 | 124-245 | GIEVLNTDPVPGSRPAEVVYWPKFKGYPEFCWNEARAQRSNDDLRPRCEPRRLNVFNVTYEDCPDQDPWVICHCSDAQQSLDDVIRR… |
| A0A437AH25 | 1-127 | MLNLLNTPVALLAAAGSVYAQLPRLLVNYPLGLSPVFDEGFFAGTVAPSATILQWAPGKAPQACVNELAWNNCQSGRAFVYNVTYAD… |
| A0A2P6NKP2 | 260-423 | None |
| A0A446BKI9 | 207-300 | None |
| A0A4S8LBR6 | 28-208 | None |
| A0A094HFP3 | 1-128 | None |
| A0A0G4LQM9 | 1-161 | None |
| A0A4S2N686 | 1-139 | None |
| A0A094HW72 | 1-128 | None |
| A0A3N4HT97 | 7-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.