DPCstruct | MC8806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 279 ± 59 aa |
| Standard deviation of domain lengths | 59.43 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N0DDH9 | 596-887 | LVPNTDLTLMLIAPNSVVHLKPNDDPVFAASIVMNVQGAVGYLPDRWVSPIACVDQHQVCNPNNDKCTPLLDRQGVIESAMKESIAL… |
| A0A437A2R8 | 36-300 | DSWLLVLVHSRQKGRERFAIALQPVSVLACLEQRQFCNPSNGRCDTPSSSRIPVYNSTELEWDNLQKDTVRVLDTITFPFIPISYLV… |
| A0A178EEN9 | 875-1219 | None |
| A0A1J9SAM4 | 347-766 | None |
| A0A1J9QXB7 | 727-1082 | None |
| A0A0C9LYQ4 | 327-658 | None |
| A0A6A6AKE8 | 104-391 | None |
| A0A0S6XPT6 | 419-753 | None |
| A0A2V1D1T8 | 211-503 | None |
| B8MSX5 | 51-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.