DPCstruct | MC8805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 161 ± 20 aa |
| Standard deviation of domain lengths | 20.33 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8NIY5 | 5-120 | IIAIATALISVVAAAPVDNPNWPGELLKRQAPGTPLYYCHDNCGQAIAGSRKTGKCSSPAFIHNYSNCIQCSGPDNNNIWHHYSTTL… |
| A0A436ZMX6 | 1-167 | MLNAQLILLGALALQGVAGVAIMDDEWHLKLLKRQAPGTPAYNCHDNCGQAITASRRDNHCEDNVFNNNYANCLQCSGPDNYNIWRY… |
| A0A2T2ZYQ7 | 16-188 | None |
| A0A1L9R8K4 | 1-161 | None |
| A0A167WDT8 | 4-135 | None |
| A0A1W2TIM2 | 6-163 | None |
| J3NWK0 | 15-186 | None |
| A0A194XCB7 | 26-171 | None |
| A0A842YT34 | 13-142 | None |
| W9ZK71 | 8-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.