DPCstruct | MC880
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 134 ± 18 aa |
| Standard deviation of domain lengths | 18.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819ZN05 | 9-123 | KYLTKAPNLLFQNLRLQLKHKLNKRKQQKFIHSRLQLLDQQQRLDIHRNLWQSYLTLGSEQQIWHKQVYKRAKTNEHESCQQFVQHR… |
| A0A819KNN5 | 1-119 | MYLQRSSWILFQTSGKRLNYSLNDKHKQYIYTRLTILDQKYCLEVHLQLCKSFLQIGRTEHHWPEEVQLLSKTDDYELSFQYLTNYT… |
| A0A815JW79 | 1-114 | None |
| A0A821A7G5 | 22-141 | None |
| A0A821IQ31 | 1-135 | None |
| A0A820A7F4 | 517-650 | None |
| A0A820P829 | 141-286 | None |
| A0A815EE06 | 1-152 | None |
| A0A816LBZ5 | 333-477 | None |
| A0A820TSI3 | 25-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.