DPCstruct | MC88
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Standard deviation of domain lengths | 11.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G4J4E3 | 199-284 | SLIARHLEAHGIPTVLMGCAKDIVEHCGVPRFMFSDFPLGNSAGKPHDLASQRQTLVLAFKVLETAVVARTTVQSPQRWGQSHEWK |
| A0A0S8KNU1 | 1-82 | MSTVLVTNMPFWAERAGAPRTLAVEFPLGQPRNAAQQMRVIRQALEVLETADTPGTIVHSEEAWPLPPEQALEEWQPAVPSP |
| A0A2E4HIL7 | 7-101 | None |
| A0A4R2JAT4 | 587-671 | None |
| A0A7C1NC54 | 2-72 | None |
| A0A3C1G6H2 | 2-54 | None |
| A0A2E7Z288 | 6-68 | None |
| A0A6L8E3C1 | 8-87 | None |
| A0A6N7Y2P7 | 6-78 | None |
| A0A523DBE1 | 213-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.