DPCstruct | MC8799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 6.55 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8I502 | 12-88 | VGELLQKMQQLTEKVEKLEPPKQKEEYYGIAGIAKILNCCNTTAQRVKNTGYIDGAIYQAGRQMLVDKEKLQSLYKE |
| A0A644VFV5 | 1-88 | MDINKPLFQLTVGEFLELQRTQMATIIPEEPVPVNEERYVHGLDGLASLLQCSRSTASRIKQSGRIDKAIRQCGRKIVIDSKEAMRLL |
| W2C9G6 | 5-105 | None |
| A0A6P1QR92 | 2-86 | None |
| A0A077E9Y7 | 8-99 | None |
| A0A137ST29 | 2-94 | None |
| A0A5J4RMF9 | 15-103 | None |
| A0A4Z0V7J0 | 8-97 | None |
| A0A7X9GRG8 | 4-93 | None |
| A0A1T4JN24 | 7-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.