DPCstruct | MC8796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 212 ± 24 aa |
| Standard deviation of domain lengths | 24.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S2JMZ5 | 85-288 | KYMANTLVSVLDQSIHVLIPSGDPDHDGSQSVDATIAPLLLVLVSLAEGNEASKKAMAKQMLPKEKDRLKPVNEGFSLSAYLIRFMT… |
| A0A1F8A9V6 | 18-250 | LNRLVDILDSATRVYSDEDLDRYGSPLVQALLLISRGVSAKLKAHLQALVLPTKEDHERVIGTGDSISARLLRHSTSVSAGQLRLLI… |
| Q2HDD3 | 260-539 | None |
| A0A1W0X5J9 | 283-523 | None |
| B6JZI7 | 207-422 | None |
| A0A317AG16 | 1-165 | None |
| H0EZC5 | 12-191 | None |
| A0A1I8F4V5 | 6-225 | None |
| A0A2A2KL26 | 362-595 | None |
| A0A4Y9YPB1 | 628-799 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.