DPCstruct | MC8795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 146 ± 25 aa |
| Standard deviation of domain lengths | 25.04 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.58 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0110- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369HJG6 | 231-403 | EKTYGPDEISRMLGDYIVQGQAMSLVMGLVDDGEGWNGPKYVAEHVFAMDYMPGSQLINEMTAWDGPRQFELMSLPLPHAGQHESDD… |
| A0A1F8A9L0 | 44-193 | RHLVDPRTRWNGPKFFEKKVLLFECVTEAYWAQRLPDWNGRKQYELLNLPHGEDGVDNERAKEAETLVQGVLSLSSTMKVWHGLVTA… |
| T4ZWR8 | 2-146 | None |
| A0A6A6A881 | 46-168 | None |
| A0A0C9U1B5 | 11-134 | None |
| N4V971 | 257-374 | None |
| J3PEX5 | 217-407 | None |
| Q0TWJ5 | 189-335 | None |
| A0A365NJK3 | 725-897 | None |
| A0A4R8Q6X4 | 92-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.