DPCstruct | MC8794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 98 ± 7 aa |
| Standard deviation of domain lengths | 6.78 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 41.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V5FWM7 | 15-112 | IPQSQLDTRSDADLISSLLSYHPVTSERNVWAFWDKGFQAMPPWTQRNVLGWIRRLGPSWAVRVLDSVSDSPNNVYRYAESADFPAA… |
| A0A0A2V280 | 1-93 | MVTPQFAIPPEFQADLNYVESLDTRSDEEIISSIDTYTPVTSEEKKYIWAFWHSGVKSMPGWCARNVVSWARLSGPSWTIRELDSIP… |
| C6HGG3 | 1-89 | None |
| A0A4Q4UU07 | 3-107 | None |
| A0A0B7K7L6 | 531-620 | None |
| C5PJ21 | 21-120 | None |
| J3PEX5 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.