DPCstruct | MC8793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 8.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 77.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A1D333 | 31-129 | TARLSRRLLIFQEARNPSNMSEIVYLPVNKLGLPICGPGPELPSILELPLRILRAFTEIFNQPKYKGWAVLAAGPYHDTSEEGKYYA… |
| A0A1F8A749 | 1-108 | MAPPPSRRLLIFQEARNPQNTAEVVYLPVNKLGLPICGPGPELPSILELPLRILKAFTDIFNQPKYKGWSIMGAGPYHDTSEEGKYY… |
| A0A1L9SRH2 | 1-102 | None |
| A0A229WKD5 | 27-135 | None |
| A0A421D8H2 | 32-132 | None |
| A0A370BXY9 | 3-94 | None |
| A0A7H8QQ92 | 44-148 | None |
| A0A7T7BNX9 | 94-211 | None |
| A0A1F5LTD7 | 7-103 | None |
| A0A1S9DJ78 | 7-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.