DPCstruct | MC8792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 436 ± 60 aa |
| Standard deviation of domain lengths | 59.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N2Q7L2 | 331-760 | DAWDQLSPDEAQERNDETKRPLNTGAQSPGCQTYQDRKRELSIDNEDAFRVVTRTPPPTGKQPIRLGNSREFFNCLESIAGFWDDTP… |
| A0A1F7ZQX5 | 53-485 | QVHDILASIRRPQDITLDKFKALNLKVETGLSASCIVRKDGPDFFPPLPWEDTSPNSSPLTEDGSPILMENGNSYPPKERFDVLKEE… |
| M2MVE6 | 75-535 | None |
| A0A177A508 | 30-430 | None |
| A0A1Q5Q9D8 | 151-561 | None |
| A0A0D2GH26 | 1-520 | None |
| A0A438N198 | 238-769 | None |
| A0A4Z1PAC5 | 53-466 | None |
| W2RUS4 | 37-565 | None |
| A7F077 | 14-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.