DPCstruct | MC879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 482 ± 65 aa |
| Standard deviation of domain lengths | 65.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0550 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5LY40 | 5-485 | QQMLNYEGAFPDFRLIDGPSVRQGRLQVKFRDRWRSVCTQVTNWTSIDTGTACRSMGYTDGGFWKWMRRNNDTYPFVMAKPDCRPGM… |
| A0A819KGE6 | 1-557 | MALLHLVIILVSFNFYQTTILPNLVGDILLTRLESPYDSTGDAIIPYGSTVTIESGTTLRFSRGSQLIVRGTLLAKGTFDRRIIFTS… |
| A0A5J4NTP3 | 8-425 | None |
| A0A3P7FH91 | 5-452 | None |
| A0A0M3J067 | 135-655 | None |
| A0A158Q5A1 | 12-580 | None |
| A0A095A4V4 | 4-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.