DPCstruct | MC8788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 354 ± 85 aa |
| Standard deviation of domain lengths | 84.71 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 79.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0V0U6 | 12-326 | LKNTRTPWPDKLKLARFAWISTQCLLPNKEQVLFDWTNHALTCFYNKKVEMPPEVVEGLWTYLDDILHSRKLHNVLSQGKTISLRLT… |
| A0A1A8DH10 | 70-435 | QMLARITSSLGPAVETFLKTNCNAADQPASTPTQAYVVEVVTAVLDCELASLSVDVEGRQNNTQLAHMTLYQVVCQQILREMSSAPR… |
| A0A2P6PJ79 | 210-515 | None |
| A0A7S3C6X4 | 2-308 | None |
| A0A7S0KQ68 | 54-590 | None |
| A0A7S0DJF3 | 8-261 | None |
| A0A3P7EE49 | 1247-1627 | None |
| A0A4Z2GT74 | 228-618 | None |
| E2BUN5 | 20-306 | None |
| A0A2N1NTH3 | 3-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.