DPCstruct | MC8787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 168 ± 14 aa |
| Standard deviation of domain lengths | 13.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 12.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A255T8D3 | 7-179 | RIILLVAFGYTLCFCSEQTSSRKECEFVLNNKELKREILYYLSLTDKYDYGIPTTCHIFYQQINDSIDRFEVMLLANGEDFRNNPYI… |
| A0A7J0AMD4 | 18-194 | LLFLTICLMMPISAKGNDGYGTLHTDCVPYARLECAQLDSFLRQYIVPLAKRNNYDINKDRLTIDFIDLKYERTNDTVYVVEVEAYL… |
| A0A4S2DI92 | 1-161 | None |
| A0A2N3A3W9 | 21-178 | None |
| A0A3R9P9K7 | 1-184 | None |
| A0A1I0N484 | 9-195 | None |
| A0A256ADM2 | 1-151 | None |
| A0A8B4QTM2 | 4-156 | None |
| A0A7X8IQD4 | 20-168 | None |
| A0A2T0T830 | 19-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.