DPCstruct | MC8786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 139 ± 20 aa |
| Standard deviation of domain lengths | 20.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 25.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09748 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q7Q5R5 | 2-123 | TSPLENLENHLEMFIENVRQIRIIVSDFQPQGQNVLNQKIQSLVTGLQEIDKLKNQIDVNVPLEVFDYIDQGRNPQLYTKDCIDKAL… |
| A0A1J5X4H4 | 6-111 | LQDMLKKNILLADELASLFYDFREEDSATTARKFDEFLSGLQEVERFAEGHTQNTRIPASVLECIDRGENPDKVTREMLVALMTENS… |
| A0A0R3TFC4 | 5-88 | None |
| A0A5J4YM45 | 56-204 | None |
| N4V7K4 | 502-662 | None |
| A0A212C8A3 | 2-103 | None |
| M1WGC9 | 2-111 | None |
| A0A1S8VFN2 | 2-129 | None |
| A0A4U5LQW9 | 122-254 | None |
| A0A1L9TE73 | 2-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.