DPCstruct | MC8785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 12.17 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9YRJ8 | 362-471 | DAPPGGQYAGWYQYFDRDIRSLLGMDVKQPFANAYCGRGKLGACRRAIWAAIAAAGDVLTAEQGTADPQGWRADANAERIEFVPGLL… |
| A0A536NVZ4 | 5-135 | SDAPGPVGSAYDESSGGWESYVNTALRQVSGQPINDAASQVYCGSTNGSPGTLSRCRDALRDALDITIAQLTAAYGTSDPAQWTCNT… |
| A0A7K0QQ83 | 282-377 | None |
| A0A535R468 | 307-428 | None |
| A0A7W0AQ23 | 61-180 | None |
| A0A7J9ZWT0 | 32-142 | None |
| A0A7Y3PLG7 | 265-388 | None |
| A0A6J7S4Z5 | 3-113 | None |
| A0A538A6P6 | 63-172 | None |
| A0A534RJE0 | 62-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.