DPCstruct | MC8784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 120 ± 11 aa |
| Standard deviation of domain lengths | 10.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5A9N4 | 220-335 | APPAIETVGPDLLQHLAARLPAYPPESKEEKSGLVLSRWLSDHGIGVSSEKSYLGGTLYSLAECPFSSAHRDGAFAIQFPNGAIHAG… |
| A0A7T1F3P1 | 220-332 | TPEKLIPVTRKQLEKLAGFLPESPRGKVNGSIDIERWLDEHNIKVSKIKNWNDGILYELEECPWNPEHKRTAYIIQFSSGGIAAKCF… |
| Q2FTE8 | 5-112 | None |
| Q1AVL8 | 1-126 | None |
| A0A7Y4R5E6 | 238-355 | None |
| A0A450S9Q0 | 21-137 | None |
| A0A450T0C6 | 232-380 | None |
| A0A0X8XY92 | 124-237 | None |
| A0A451AQC7 | 58-184 | None |
| A0A2V2SMQ7 | 178-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.