DPCstruct | MC8783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 111 ± 19 aa |
| Standard deviation of domain lengths | 19.48 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536NKR8 | 9-131 | VDVDYVEVECKSALNPVKNMGFSWSLNPYTGCEHRCSFCYVRAFELRADRPSDDRYGRTVRIKTNVAAVLRSELSRRSWRKEAVVIG… |
| A0A1V4X220 | 1-104 | MNIREIAAKNAIARTGIEGYDYCLNPYVGCGHGCRYCYAAFMKQFTGHSEPWGDFVDVKANVADVLQRQLRRIRGGTLLIGTVTDPY… |
| A0A2M8GME9 | 2-90 | None |
| A0A6N8VXI3 | 2-95 | None |
| A0A426TRE3 | 1-138 | None |
| A0A806JYZ6 | 26-90 | None |
| A0A3E1E7S4 | 35-198 | None |
| A0A3A9GBU6 | 3-109 | None |
| A0A6S7BZH0 | 49-144 | None |
| A0A1Y1XKU5 | 4-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.