DPCstruct | MC8782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 156 ± 24 aa |
| Standard deviation of domain lengths | 23.90 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 17.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q0TIU0 | 56-253 | STSTTVLSSHADVSSEAVDNIDQLIALAAKTSASAPAVYPIKPVKMQDFATVFPTVEMKVVSLDGNKRMVTVSGYQMEGAESVIYLG… |
| A0A484ZGF9 | 19-200 | AEKQSDADILYTLNQKPIFANKGDKEPEGSLLPASEVKVLKRDGDWLQVSIEGWTETEGRQRVLSLLPGKRIFVSTLRGEVQERAKV… |
| C8NAR0 | 152-322 | None |
| A0A2N6BPL9 | 24-202 | None |
| A0A4R1KH48 | 6-151 | None |
| A0A5R9QU52 | 11-143 | None |
| A0A2G6R5Z0 | 17-167 | None |
| A0A3C1BGF9 | 20-164 | None |
| A0A1Q7LF81 | 30-162 | None |
| A0A378N8C4 | 1-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.