DPCstruct | MC8781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 169 ± 18 aa |
| Standard deviation of domain lengths | 18.19 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.86 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF19436- PF03598 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1QBR9 | 8-160 | VPIGPVYEGERIRAKQMYVELGGPKMEKHFELCRVVSKKEIKDGQVTIHGIDLKDMEEGSTHPIGILVEVAGPELEVDLEAVFERRV… |
| A0A7C3XWJ8 | 2-203 | EEQGKPDIILKEDTAVELGPPGRSSFQTVSLVQSPFILEDGLITLVGPDLPEARGRDLPFGQVLWVAGEGLKKDHLRELERKQLISN… |
| A0A0F9GV35 | 8-178 | None |
| A0A2H6JX87 | 15-167 | None |
| A0A7C0Y7L3 | 65-241 | None |
| A0A2D5URR8 | 256-422 | None |
| A0A3D5HVV8 | 1-152 | None |
| A0A6J4UEA3 | 168-315 | None |
| A0A7V5SRY0 | 43-236 | None |
| A0A2G9XHP9 | 16-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.