DPCstruct | MC8780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 144 ± 36 aa |
| Standard deviation of domain lengths | 36.42 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 90.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.47 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | CL0344- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A421CGN6 | 2-120 | DQVRENIETAREAAPDSLTPSELATVERVKAEYIRRIKVNCTGCSYCMPCPSGVAIPTSFDFFNDAFMFDNIEDQKKVYLRFVKEEN… |
| A0A7C3V1G7 | 28-153 | TVIVGTMDAPRLERDLEIAQAEGYELTVEELTLLNTVRERYRKLRPIPCLSCYLCMPCPVGIDAPRVMELFNDASVYGDLQIPKTFY… |
| A0A1F2VVT4 | 1-104 | None |
| A0A7C1KXK0 | 44-264 | None |
| A0A1V5ZAR7 | 3-99 | None |
| A0A3E4JJ48 | 696-859 | None |
| A0A7G8ILV9 | 227-373 | None |
| A0A316LSL3 | 2-108 | None |
| A0A3D3XZ18 | 25-150 | None |
| A0A7U9R7K9 | 48-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.