DPCstruct | MC878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 401 ± 57 aa |
| Standard deviation of domain lengths | 56.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.37 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | CL0020- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1WLG4 | 263-705 | KDEADLDVCWQHTCLYMHSMIYTKPDIDRFNKWLTYAYLPLLKARIASPSSVKLGTRIAILDLSAVHQYRKCGTKPFAPIADECQCA… |
| A0A819K029 | 4-347 | RTTRYHGTKLILELLENEYLLSAIKTFCDWLAGNKRLLQMLLPISPGLWSKLALLLNFLPHERDIIKSGLIPPTSPIHPLLIKFMET… |
| A0A7E6CWV9 | 510-881 | None |
| A0A4S4LVD3 | 3-466 | None |
| A0A7J6A0C2 | 707-1085 | None |
| A0A3N4LIN0 | 699-1121 | None |
| A0A0B1PS01 | 659-1089 | None |
| A0A820H8W8 | 1-298 | None |
| A0A7J5XR63 | 345-702 | None |
| A0A2R7WM64 | 2-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.