DPCstruct | MC8776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 4.60 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A137QR56 | 1-64 | MGRWTQFDEDSARLPEGMKRVGYDADTRQYTFLESSTGMLYESAPGNEYGILRPIGRSANDQQK |
| A0A1B7N8B7 | 1-70 | MSRFTQFDEDSYRLPEGVKRIAYDADTQQYTFRDPSGQLYQNAPGENYGVLKPVSTPATPRRRVTITGEL |
| A0A395T5L8 | 1-71 | None |
| A0A179F797 | 1-65 | None |
| A0A3S4C8F6 | 1-68 | None |
| A0A4S8LGS5 | 1-76 | None |
| A0A1C7LML4 | 1-60 | None |
| J3P3B3 | 2-65 | None |
| A0A0C2YUM4 | 1-69 | None |
| A0A6G1HL57 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.