DPCstruct | MC8773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 10.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.03 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0123- CL0734 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9FWC1 | 1-95 | MNSFQVKYVNPITKICIFRTSREDYQKIWAAITMVKSVGNCPVVFNLLDLSGSIKACKRAALKCDGLKFEQYKLAAGDQLPADMEQR… |
| A0A1D1W2T0 | 2-122 | TALKDLHGEQGVAAQLNDVRVKYLNPETGIVFLRARRGPHLMVKDAIESLLRVGNIPAAVKIIHISGTMRSSQKRLLEHHRRHLLKS… |
| A0A2T0FD43 | 44-143 | None |
| A0A1I7WC54 | 36-155 | None |
| A0A6P7TV99 | 2-107 | None |
| D8QZY1 | 218-325 | None |
| A0A183T5N9 | 175-298 | None |
| A0A164ZLD5 | 38-128 | None |
| A0A0D3CHI2 | 43-139 | None |
| A0A811QXM9 | 169-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.