DPCstruct | MC8771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 618 ± 49 aa |
| Standard deviation of domain lengths | 49.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.30 |
| Pfam Score | 79.46 |
| Assigned Pfam label(s) | CL0465- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8SXS0 | 2-566 | QGSDCIFEAVEQQDLDSVQILLYQFSAEELDLNTPNSQGLTPLDISIMTNNTPIAKLLLRAGGRESPHFVSVEAREALIGSLVQEAE… |
| A0A1D1VS52 | 86-732 | KSQHSSRQSARKPRRDGSLSSADVQKSSARWRSPSISRSVQRNFQSLISFLFERKHDARKRALAEQLLWTALRRQETALFGDILNQL… |
| A0A212FHP0 | 120-759 | None |
| A0A834FDQ9 | 1-627 | None |
| A0A7J7J4X5 | 319-954 | None |
| J9NX50 | 103-727 | None |
| A0A674CJ61 | 1-494 | None |
| A0A016WBS9 | 1-553 | None |
| A0A6A4X1F3 | 28-604 | None |
| A0A6P7LB19 | 251-909 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.