DPCstruct | MC8770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 7.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14913 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813SQC0 | 113-196 | RIRNLPYPVDIYQLTIDKDKREFVLRTTNKKYFKRFSIADLDRLNLPLEESNLAYSHANNTLIITYKKPKAILDFEKTVHDELK |
| A0A7S1EEV7 | 92-176 | WRVRNMPYPKETYQVTADDEKNQVVIRTTNKKYFKRIDVPDLNRLGLRVEEGGISIAHANRTLVVSLKKPQKILELEAELRKERK |
| A0A7J7TSX9 | 23-116 | None |
| A0A2P8Z2E7 | 84-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.