DPCstruct | MC877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 194 ± 34 aa |
| Standard deviation of domain lengths | 34.36 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.35 |
| Pfam Score | 93.81 |
| Assigned Pfam label(s) | CL0465- CL0449 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7DZT9 | 15-209 | PVWGPTTRSKKRLVFVKATGVHLRTVEPAARAADEEDSASFYKRITTERAVSPDFMEIPAPEQLNRCTVCAVTYPRGRADEHHRSLA… |
| A0A212FKR3 | 61-195 | NVHTKSNETYHKKKSKYTCTICDNRTFDSKDEHLSSTIHNINASKGIKVPTKYAIPETNKGFQLMLKGGWDKESGLGRDGLGTKYPI… |
| A0A1Z5SYB8 | 2-237 | None |
| A0A7R9WBN6 | 28-187 | None |
| A0A183X006 | 78-296 | None |
| A0A6J2UFR5 | 82-231 | None |
| A0A3M6U3T9 | 201-361 | None |
| D7G351 | 29-203 | None |
| A0A0J9XFD9 | 1-202 | None |
| A0A4U8UQB1 | 56-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.