DPCstruct | MC8769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 132 ± 13 aa |
| Standard deviation of domain lengths | 13.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820EI42 | 1-130 | MAEIFGYDVYKGLGLTAEAERAKSLSMANSDNFPRPNTYWFRDWLYPWYIQGQETKVLVNYFKLVAQYFPKYTGTNQYARSMNWGEF… |
| A0A2U0ZIJ2 | 191-323 | EIYQYDVYLGLGRKADAQRWEAMMVADSHSDNFPQANTHWFRDWWLPVYNQYGGTKVLSNYFLLLSKYFPSKTLEDGTKEYTRDMNW… |
| A0A5B9W958 | 521-662 | None |
| A0A815FTQ8 | 330-491 | None |
| A0A818VUA9 | 401-531 | None |
| A0A3Q8I3J0 | 167-292 | None |
| A0A1D2MAF4 | 270-397 | None |
| A0A818Q5B6 | 220-350 | None |
| A0A1W0WCQ2 | 65-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.