DPCstruct | MC8766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 113 ± 13 aa |
| Standard deviation of domain lengths | 12.89 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D1W5F0 | 1-116 | MSDDVWKQATLPVDKGGLGIRRAEQIALPAYLASIYSARRLVSGMIADFDVDDLCADELASWSVQSGTEPPIAALRGVQRVWGQPLA… |
| A0A6A4VR21 | 65-182 | RLRGDSWRQATLPVNLGGLGVRMVTDVALPAHIASQVASADTIASIYGSAAARVGEATRCLVEEWEAHTGLPSPDVSRQRYQRDWDR… |
| A0A1D1W7W2 | 1-94 | None |
| A0A1D1W783 | 98-228 | None |
| T1FE76 | 391-502 | None |
| A0A1W0X9J1 | 205-315 | None |
| A0A6A4VRR0 | 237-352 | None |
| A0A2P8YGC7 | 84-200 | None |
| A0A6A4VGW9 | 60-176 | None |
| T1FJU5 | 208-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.