DPCstruct | MC8764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 136 ± 22 aa |
| Standard deviation of domain lengths | 21.67 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05439 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A315WC94 | 545-678 | VLVLHALFWGLVSLRVFGAALLSEEKTTAVKPVVAPCWLLENFVVLEECNRCSDFNSKTQTICKQTGYVERVNCTKTSRQEYKSCRS… |
| A0A1D1VDI3 | 61-211 | SLSGGAPEIPRLNDSLVDKIAVIFPPATASTVGISSQVVESCGTGKVLQVEGSCRLCTMFEVTSKASFCQQTGYKEPFRCVASSKHV… |
| F4PPV1 | 138-280 | None |
| A0A814YYB1 | 3-121 | None |
| A0A401RNF3 | 84-222 | None |
| A0A7J7F959 | 196-316 | None |
| A0A819PCN5 | 17-148 | None |
| A0A672UY80 | 11-136 | None |
| A0A7S2SNV0 | 11-167 | None |
| A0A2H3CFC3 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.