DPCstruct | MC8762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21772 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9P653 | 42-155 | EELQMLMFSETLAMVSDTGEPEGELTIEVQRGKYKDELGMMSSCVLVHAFSRGFMDRMLCGNSLLGYLSWKLHIMEQHSQEFIKFHI… |
| Q4RAN0 | 1-115 | PAELQGCVFADSLVTLSKGGQVLGNFTVTVEFARRDQEPCMLLHAQSRGTIDHCPCGTTVTAYLTTDLEVLEEHYQEYVRGSSLEKK… |
| K7G637 | 1-126 | None |
| V4AT53 | 66-169 | None |
| A0A814FBU8 | 20-124 | None |
| A0A498NNJ3 | 29-138 | None |
| A0A151MYT2 | 340-454 | None |
| A0A2U9BKQ9 | 416-525 | None |
| A0A087YAH0 | 83-191 | None |
| A0A6I8ND52 | 84-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.