DPCstruct | MC876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 9.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372RS18 | 18-97 | AKKKALTHLENFVREDDSAKYVIDPKNVVCRKDDNADKVSCLKLNELDEKEIFSQMQKLGFYCALAQDPNNIGLECNKVQ |
| G7DYA9 | 7-87 | RKGVESFVRSVPMQGLVTFDSERDAKVAKLCRLSSSGQRECNEVALHSRQLFEHLTKLGFFCTSPIDPSKTEIECRRIAKA |
| A0A421JDT4 | 281-366 | None |
| A0A316UAY0 | 6-97 | None |
| S2JM69 | 11-88 | None |
| A0A0E9N938 | 38-130 | None |
| A0A1Y2D7B0 | 14-96 | None |
| J4UH31 | 138-224 | None |
| A0A066WNA9 | 36-141 | None |
| A0A1C7N3E4 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.