DPCstruct | MC8758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 255 ± 41 aa |
| Standard deviation of domain lengths | 40.68 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3D1A4 | 20-251 | QEYKRKIPAHKMTEMQAKIDEERKTLEAKLDMEEEEKNKAKAELEKRENDLLKAREEHQLLLAKLSKLEKKVIGLLAKAEEQERLLQ… |
| A0A444UW98 | 3-203 | EMQAKIEEERKALEAKLDMEEEERNKARAELEKREKDLLKAQQEHQLLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNNELDER… |
| A0A7S3K9V6 | 23-312 | None |
| A0A3P7LNQ6 | 59-308 | None |
| A0A2T7PIF4 | 601-850 | None |
| A0A821VQ54 | 106-353 | None |
| A0A6P7FS97 | 699-905 | None |
| W2SK47 | 391-609 | None |
| A0A6G0YN77 | 401-679 | None |
| A0A183TVG7 | 276-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.