DPCstruct | MC8757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 161 ± 19 aa |
| Standard deviation of domain lengths | 19.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03390 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A854XLX7 | 2-119 | FNQVIMTNLTHAILAGIGLALIDLNTLASAFTWQFVVLGLTSVVVMGLASWFLARLFGLYPVETAIGAGMINNSMGGTGNIAVLSAS… |
| G4D4V4 | 24-199 | AMLLGLTFYQVGVVFSKTLWPMVSTQVPIHQFAWMIVFVALANGLGIIPGELRTACKKMQTFFTKNMILIIMVGVGADTSLFELGAA… |
| A0A197JCD0 | 504-677 | None |
| A0A395YJM3 | 9-162 | None |
| A0A5S9MG82 | 1-171 | None |
| A0A4R9BI45 | 49-188 | None |
| A0A2Z6EVZ7 | 2-158 | None |
| Q7P4U2 | 2-137 | None |
| A0A2X2YCA5 | 41-228 | None |
| A0A663BJC1 | 14-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.