DPCstruct | MC8756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Standard deviation of domain lengths | 9.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 96.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V6IMV7 | 39-121 | MAACSGRELMTEILGQLRIESGAARILETTVVIPCMMPFITSQFLRREKGDRPAVAPEGWRNLGFVGQFVELPDDVVFTVEYS |
| A0A0P0DT43 | 2-74 | YHLGVPESQISELASEENMNTVPVYMPYITSYFMPRHDGDRPAVVPEGSVNIAFIGNFAESPTRDTVFTTEYS |
| A0A5F0E1S8 | 1-83 | None |
| A0A6I3RF47 | 107-191 | None |
| A0A831RY80 | 22-106 | None |
| R7ACN4 | 48-132 | None |
| E8JPK5 | 1-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.