DPCstruct | MC8753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 120 ± 10 aa |
| Standard deviation of domain lengths | 10.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 55.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7FWR9 | 1-117 | MENSPDETFDPENVKFQYLFYSLRQEFLQQLKEIYQRSCQNRSNLLLLIEWLSISNPILAAKLILERNDVIAKRIDGNLMVSPCKSE… |
| A0A1S0UDF6 | 1-120 | MENTKEKGTDPENTKLQYLYNILQEQFQQKFNEIYQNSCRNRNNLLTLIEWISHDNLTVAANLVLQRNDVIAKHINGSLQIAPFKSN… |
| A0A1I7W4R6 | 77-169 | None |
| A8PMR2 | 121-251 | None |
| A0A5S6PDB3 | 285-413 | None |
| J9B9W6 | 1-112 | None |
| J9AEQ8 | 170-281 | None |
| A0A1I8EWS3 | 85-203 | None |
| A0A1I9GAY6 | 1-132 | None |
| A0A1I8EEZ4 | 87-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.