DPCstruct | MC8751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 282 ± 45 aa |
| Standard deviation of domain lengths | 44.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.53 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | PF18991- PF13569 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z0IN73 | 46-296 | LKTVPPKAKKTETYEKLESLRSYLHQHDVQCADTVREWFLKGLPVPVTVIAAVWIDPAWRYYLNDLVISTDDGTVGLLRAASKEHGL… |
| A0A4P7R3Y5 | 704-972 | ALYRLAERRKTTVDELVDRSVPVSGFGQPGVPPLAALLNLERARLQAAMDLGRRWKPQDWESGIAAHLLLRRLARSLVWLAVDDQRV… |
| A0A0E2E0P2 | 12-220 | None |
| A0A7W0Q2Y9 | 651-966 | None |
| A0A423D1A0 | 325-586 | None |
| M6YHL5 | 123-478 | None |
| A0A850JAJ4 | 4-254 | None |
| A0A1X1NJ68 | 374-686 | None |
| A0A059U1U0 | 397-701 | None |
| A0A366DVY8 | 5-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.