DPCstruct | MC8747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 96 ± 15 aa |
| Standard deviation of domain lengths | 14.62 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6R1B9 | 200-278 | LPIELRGIQETVAEGRGVWRSCSGCHELDEGHDTGPRSKVFGCALGVGCSECGGIGAVWDTTDYGAMGDALADSMAKPQ |
| A0A6I1NT92 | 133-211 | SPEPVELAGVAAQLKNGFWDSCSGCHETEDGHPVGKYPYSQLFGCALGAGCGECGGIGAVWDSTDYDEVAKAAVLNGES |
| A0A285UKX9 | 28-125 | None |
| A0A0A3XRC1 | 135-264 | None |
| A0A439F4D5 | 4-91 | None |
| A0A0Q7MQJ3 | 3-83 | None |
| A0A8A9QUV3 | 39-120 | None |
| A0A1H9QFA0 | 40-137 | None |
| A0A024K8M5 | 193-295 | None |
| A0A7X5Y1L6 | 47-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.