DPCstruct | MC8746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 137 ± 14 aa |
| Standard deviation of domain lengths | 13.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L1KG79 | 5-124 | EALTALYNELDRVGVGLILKHWSGNQWALVLPDASEPGKFRYQAFGLHGWITHHTCTTLDEVVSDAFCAGFRMVASPDTLDRVASTV… |
| A0A6I1NQ26 | 7-162 | RCDFAVRAANLRVSFTDTGKDDASLNVWVEQAAKELEEKQVVLDAMLKLYDEQGIGSIYKDKHGRYGFVLADASEEGAFRYQLFDAN… |
| A0A5B0SVP7 | 10-130 | None |
| A0A7X4XER3 | 39-204 | None |
| A0A192A898 | 18-153 | None |
| A0A1Z3ML06 | 15-136 | None |
| A0A2N4UQ08 | 23-178 | None |
| A0A7Y8GX49 | 8-137 | None |
| A0A2N2AMG5 | 271-389 | None |
| A0A2E6Z818 | 54-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.